SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009081 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009081
Domain Number 1 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 4-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 234-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 528-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000336
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 201-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000368
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 337-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000119
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 150-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000277
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 574-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000374
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009081   Gene: ENSMMUG00000004337   Transcript: ENSMMUT00000009667
Sequence length 636
Comment pep:known chromosome:MMUL_1:19:43293388:43313633:-1 gene:ENSMMUG00000004337 transcript:ENSMMUT00000009667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLMMFRDVAVDFCQEEWECLDLEQRDLYRDVMLENYSNLVSLGLCIYQPEVFSLLEKG
KEPWKILRDETRGPCPDMQSRCQTKKLLPKNGICEREIAQLEIMKICKNHSLECLCFRGD
WEGNVQFQTLQDNQEECFKQVILTCEKRPTFNQHTAFNLHQRLNTGDKLNEFKELGKAFI
SGSDHTQHQLIHTIVKFCEDKECENTFLPDSEVTQHQTVHTVKKTYECKECGKSFSLRSS
LTGHKRIHTGEKPFKCKECGKAFRFHSQLSVHKRIHTGEKSYECKECGKAFSCGSDLTRH
QRIHTGEKPYECNECRKAFSQRSHLIKHQRIHTGEKPYECQECGKAFTRGSHLTQHQRIH
TGEKSHECKECGKAFIRGSNLAQHQNVHVGRKPYECEKCGKAYIWSSHLARHQRIHTGRK
PYECKQCGKTFTWPSYLAQHEKIHNERKSYECKDCGKTFLHGSEFNRHQKIHTGERDYEC
KECGKTFLRGSELNRHQKIHTGKRPYECEECGKAFLWGSQLTRHQRMHTGEEPYVCKECG
KSFIWGSQLTRHKRIHTDAEPYGCKKSSHIFSHHSYFTEQKIHNGANLCEWTDYGNSFSH
ESSFAQHQNIYTFEKSYEFKDFEKAFSSSSHFISLL
Download sequence
Identical sequences A0A2K5TU43 F7EV38
NP_001248600.1.72884 XP_014979060.1.72884 XP_014979061.1.72884 XP_014979062.1.72884 XP_014979063.1.72884 XP_014979064.1.72884 XP_014979065.1.72884 XP_015296570.1.63531 XP_015296571.1.63531 XP_015296572.1.63531 XP_015296573.1.63531 XP_015296574.1.63531 XP_015296575.1.63531 ENSMMUP00000009081 ENSMMUP00000005800 9544.ENSMMUP00000009081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]