SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009500 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009500
Domain Number 1 Region: 578-915
Classification Level Classification E-value
Superfamily NHL repeat 9.94e-26
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 817-848,880-901,928-1021
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.0000000366
Family Putative isomerase YbhE 0.034
Further Details:      
 
Domain Number 3 Region: 273-348
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000102
Family Pre-dockerin domain 0.073
Further Details:      
 
Domain Number 4 Region: 91-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000062
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number 5 Region: 121-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000692
Family EGF-type module 0.042
Further Details:      
 
Domain Number 6 Region: 25-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00008
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000009500
Domain Number - Region: 148-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000219
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 57-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0175
Family Integrin beta EGF-like domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009500   Gene: ENSMMUG00000007240   Transcript: ENSMMUT00000010121
Sequence length 1044
Comment pep:known_by_projection chromosome:MMUL_1:5:174794201:174876593:1 gene:ENSMMUG00000007240 transcript:ENSMMUT00000010121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCACNSGYKGENCEEADCLDPGCSNHGVCIHGECHCSPGWGGSNCEILKTMCPDQCSG
HGTYLQESGSCTCDPNWTGPDCSNEICSVDCGSHGVCMGGTCRCEEGWTGPACNQRACHP
RCAEHGTCKDGKCECSQGWNGEHCTIEGCPGLCNSNGRCTLDQNGWHCVCQPGWRGAGCD
VAMETLCTDSKDNEGDGLIDCMDPDCCLQSSCQNQPYCRGLPDPQDIISQSLQSPSQQAA
KSFYDRVSFLIGSDSTHVIPGESPFNKSLASVIRGQVLTADGTPLIGVNVSFFHYPEYGY
TITRQDGMFDLVANGGASLTLVFERSPFLTQYHTVWIPWNVFYVMDTLVMKKEENDIPSC
DLSGFVRPNPIIVSSPLSTFFRSSPEDSPIIPETQVLHEETTIPGTDLKLSYLSSRAAGY
KSVLKITMTQSIIPFNLMKVHLMVAVVGRLFQKWFPASPNLAYTFIWDKTDAYNQKVYGL
SEAVVSVGYEYESCLDLTLWEKRTAILQGYELDASNMGGWTLDKHHVLDVQNGILYKGNG
ENQFISQQPPVVSSIMGNGRRRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNYV
RRIFPSGNVTSVLELRNKDFRHSSNPAHRYYLATDPVTGDLYVSDTNTRRIYRPKSLTGA
KDLTKNAEVVAGTGEQCLPFDEARCGDGGKAVEATLMSPKGMAIDKNGLIYFVDGTMIRK
VDQNGIISTLLGSNDLTSARPLTCDTSMHISQVRLEWPTDLAINPMDNSIYVLDNNVVLQ
ITENRQVRIAAGRPMHCQVPGVEYPVGKHAVQTTLESATAIAVSYSGVLYITETDEKKIN
RIRQVTTDGEISLVAGIPSECDCKNDANCDCYQSGDGYAKDAKLNAPSSLAASPDGTLYI
ADLGNIRIRAVSKNKPLLNSMNFYEVASPTDQELYIFDINGTHQYTVSLVTGDYLYNFSY
SNDNDITAVTDSNGNTLRIRRDPNRMPVRVVSPDNQVIWLTIGTNGCLKSMTAQGLELVL
FTYHGNSGLLATKSDETGWTTFFE
Download sequence
Identical sequences ENSMMUP00000009500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]