SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009593 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009593
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.02e-27
Family KRAB domain (Kruppel-associated box) 0.00085
Further Details:      
 
Domain Number 2 Region: 277-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.22e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 389-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-22
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 626-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 546-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-17
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 236-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.45e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 9 Region: 435-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-16
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 10 Region: 516-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000015
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 166-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000893
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009593   Gene: ENSMMUG00000007317   Transcript: ENSMMUT00000010225
Sequence length 684
Comment pep:known chromosome:MMUL_1:10:17957947:17971033:1 gene:ENSMMUG00000007317 transcript:ENSMMUT00000010225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKFQRSVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGYHVSKPDVIFKL
EQGEEPWIVEEFSNQNYPEVNDALEKNKEIQDKHLTQTVFFGNKTLITERENVFGKTLNL
GMNSVPSRKIPYKCNPGGNSLKTNSEVIVAKKSKENRKIPDEYSGFGKPLLHTKHEKSHS
GMKSYRYNPMRKASNQNESLILHQNIQILKQPFDYNKCGKTFFKRAILVTQKGRQTERKP
NECSECRKTFSKRSTLIVHQRIHTGEKPYVCNDCRKTFRVKTSLTRHQRIHTGERPYECS
ECGKTFIDKSALIVHQKIHGGEKSYECNECGKTFFRKSALAEHFRSHTGEKPYECKECGN
AFSKKSYLVVHQRTHRGEKPNECKECGKTFFCQSALTAHQRIHTGEKPYECSECEKTFFC
QSALNVHRRSHTGEKPYECSQCGKFLCTKSALIAHQITHRGKKSYECNECGKFFCHKSTL
TIHQRTHTGDKHGVFNKCGRISIMKSNCSQCKRMNTKENLYECSEHGHAISKNSHLIVHQ
RTIWERPYECNECGRTYCRKSALTHHQRTHTGERPYECNECGKTFCQKFSFVEHQRTHTG
EKPYECNECGKSFCHKSAFRVHRRIHTGEKPYECNQCGKTYRRLWTLTEHQKIHTGEKPY
ECNKCEKTFRHKSNFLLHQKSHKE
Download sequence
Identical sequences F7F2F6
ENSMMUP00000009593 XP_015004385.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]