SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009708 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009708
Domain Number 1 Region: 384-456
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.06e-32
Family Small-conductance potassium channel 0.0000254
Further Details:      
 
Domain Number 2 Region: 253-426
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009708   Gene: ENSMMUG00000007398   Transcript: ENSMMUT00000010346
Sequence length 463
Comment pep:known_by_projection chromosome:MMUL_1:19:17545756:17566293:1 gene:ENSMMUG00000007398 transcript:ENSMMUT00000010346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGPRAACSEPNPCTQVVMNSHSYNGSVGRPLGSGPGALGRDPPDPEVGRPPQPPHSPGLQ
VVVAKSEPARPSPGSPRGQPQDQDDDEDDEEDEAGRQRGSGKPSNVGHRLGHRRALFEKR
KRLSDYALIFGMFGIVVMVTETELSWGVYTKESLYSFALKCLISLSTAILLGLVVLYHAR
EIQLFMVDNGADDWRIAMTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAE
ADVDVLLSIPMFLRLYLLGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPG
TVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCG
KGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETW
LIYKHTRLVKKPDQARVRKHQRKFLQAIHHGRMLRSVKIEQGK
Download sequence
Identical sequences 9544.ENSMMUP00000009708 ENSMMUP00000009708 ENSMMUP00000009708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]