SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009831 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009831
Domain Number 1 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 2 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-22
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 488-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 534-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 432-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 2-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 9 Region: 170-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-17
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000009831
Domain Number - Region: 118-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00157
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009831   Gene: ENSMMUG00000007485   Transcript: ENSMMUT00000010474
Sequence length 628
Comment pep:known chromosome:MMUL_1:19:2674356:2687824:1 gene:ENSMMUG00000007485 transcript:ENSMMUT00000010474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVVFEDVAVDFTLEEWALLDSAQRDLYRDVMLETFRNLASVDDETQFKASGSVSQQDI
YGEKIPKESKIAAFTRNVSWASVLGKIWDSLSIEDQPTKQGRNLSRNHVLERVCESNDQC
GEAFSQIPHLNLYKKIPPGVKQCEYNTYGKVFMHHRTSLKSPITVHTGHKLYQCQECGQA
YSCRSHLRMHVRTHNGERPYVCKLCGKTFPRTSSLNRHVRIHTAEKTYECKQCGKAFIDF
SSLTSHLRSHTGEKPYKCKECGKAFSYSSTFRRHTITHTGEKPYKCQECGEAFSYSSTFR
RHMISHTGEKPHKCKECGEAFSYSSTFRRHMITHTGEKPYECKQCGKTFIYLQSFRRHER
IHTGEKPYECKQCGKTFIYPQSFRRHERTHGGEKPYECNQCGKAFSHPSSFRGHMRVHTG
EKPYECKQCGKTFNWPISLRKHMRTHTREKPYECKQCGKAFSLSACFREHVRMHPEDKSY
ECKLCGKAFYCHISLQKHMRRHTAEKLYECKQCGKAFSWPELLQQHVRTHTVEKPYECKE
CGKVFKWPSSLPIHMRLHTGEKPYQCKHCGKAFNCSSSLRRHVRIHTTEKQYKCNMEHPP
TNEFMCNASEKSHQERDLIKVVNMVLPL
Download sequence
Identical sequences F6QLF7
9544.ENSMMUP00000009831 ENSMMUP00000009831 ENSMMUP00000009831 XP_014977918.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]