SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009883 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009883
Domain Number 1 Region: 663-724
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000136
Family VWC domain 0.0043
Further Details:      
 
Domain Number 2 Region: 49-127
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000555
Family VWC domain 0.019
Further Details:      
 
Domain Number 3 Region: 742-811
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000408
Family VWC domain 0.06
Further Details:      
 
Domain Number 4 Region: 830-893
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000126
Family VWC domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009883   Gene: ENSMMUG00000007528   Transcript: ENSMMUT00000010533
Sequence length 915
Comment pep:known chromosome:MMUL_1:2:102273612:102283317:-1 gene:ENSMMUG00000007528 transcript:ENSMMUT00000010533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLPAPPAPLLLLGLLLLGSRPARGAGPEPPALPIRSEKEPLPVRGAAGCSFGGKVYAL
DETWHPDLGEPFGVMRCVLCACEALQWGRRTRGPGRVTCKNIKPECPTLACGQPRQLPGH
CCQTCPQERSSSERQPSGLSFEYPRDPEHRSYSDRGEPGAEERARGDGHTDFVALLTGPR
SQAVARARVSLLRSSLRFSISYRRLDRPTRVRFSDSNGSVLFEHAAAPTQDGLVCGVWRA
VPRLSLRLLRAEQLHVALVTLTHPSGEVWGPLIRHRALAAETFSAILTLEGSPEQGIGGI
TLLTLSDTEDSLHFLLLFRGLLEPRSGGLTQVPLRLQILHQGQLLRELQANVSAQEPGFA
EVLPNLTVQEMDWLVLGELQMALERAGRPGLRISGHIATRKSCDVLQSVLCGADVLIPVQ
TGAAGSASLTLLGNGSLIYQAVGICPGLGARGAHMLLQNELFLNVGTKDFPDGELRGHVA
ALPYSGHSARHDRLPVPLAGALVLPPVKSQAAGHAWLSLDTHCHLHYEVLLAGLGGSEQG
TVTAHLLGPPGTPGPRRLLKGFYGPEAQGVVKDLEPELLRHLAKGMASLLIATKGSPRGE
LRGQVHIANQCEVGGLRLGAAGVEGVREPGAPDTAAAAPPVVPGPLALAPAKPGGPGRPR
DPNTCFFEGQQRPHGARWAPNYDPLCSLCTCQRRTVICDPVVCPPPSCPHPVQTPDQCCP
VCPEKQDVRDLPGLPRSRDPGEGCYFDGDRSWRAAGTRWHPVVPPFGLIKCAVCTCKGGT
GEVHCEKVQCPRLACAQPVRVNPTDCCKQCPVGLGAHPQLGDPMQADGPRGCRFAGQWFP
ESQSWHPSVPPFGEMSCITCRCGAGVPHCERDDCSLPLSCSLGKESRCCSRCTARRRPAP
ETRTDPELEKEAEGS
Download sequence
Identical sequences ENSMMUP00000009883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]