SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010306 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010306
Domain Number 1 Region: 194-351
Classification Level Classification E-value
Superfamily PHM/PNGase F 4.71e-56
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.0000000501
Further Details:      
 
Domain Number 2 Region: 45-191
Classification Level Classification E-value
Superfamily PHM/PNGase F 3.82e-52
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.0000000603
Further Details:      
 
Domain Number 3 Region: 512-810
Classification Level Classification E-value
Superfamily NHL repeat 6.02e-35
Family NHL repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010306   Gene: ENSMMUG00000007844   Transcript: ENSMMUT00000010989
Sequence length 889
Comment pep:known chromosome:MMUL_1:6:99112043:99278884:1 gene:ENSMMUG00000007844 transcript:ENSMMUT00000010989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRVPSLLVLLLVFPSSCLAFRSPLSVFKRFKETTRPFSNECLGTTRPVIPIDSTDFAL
DIRMPGVIPKQSDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYW
FCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHK
DCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYPMHVFAYRVHTH
HLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVEHPVDVSFGDLLAARCVFTGEGRTEAT
HIGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPDTFRTIPPEANIPIPVKSDMVMMH
EHHKETEYKDKIPLLQQPKREEEEVLDQGDFYSLLSKLLGEREDVVHVHKYNPTEKAESE
SDLVAEIANVVQKKDLGRSDAREGAEHERGNAILVRDRIHKFHRLVSTLRPPESRVSSLQ
QPLPGEGTWEPEHTGDFHMEEALDWPGVYLLPGQVSGVALDPKNNLVIFHRGDHVWDGNS
FDSKFVYQQIGLGPIEEDTILVIDPNNAAVLQSSGKNLFYLPHGLSIDKDGNYWVTDVAL
HQVFKLDPNNKEGPILILGRSMQPGSDQNHFCQPTDVAVDPGTGAIYVSDGYCNSRIVQF
SPSGEFITQWGEESSGSSPLPGQFTVPHSLALVSHLGQLCVADRENARIQCFKTDTKEFV
REIKHSSFGRNVFAISYIPGLLFAVNGKPHFGDQEPVQGFVMNFSSGEIIDIFKPVRKHF
DMPHDIVASEDGTVYIGDAHTNTVWKFTLTEKVEHRSVKKAGIEVQEIKGKGSGGLNLGN
FFASRKGYSRKGFDRLSTEGSDQEKEEDDGSESEEEYSAPLPAPAPSSS
Download sequence
Identical sequences ENSMMUP00000010306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]