SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010347 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010347
Domain Number 1 Region: 310-369
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000398
Family RING finger domain, C3HC4 0.033
Further Details:      
 
Domain Number 2 Region: 96-120
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000366
Family CCCH zinc finger 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010347
Domain Number - Region: 239-263
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000249
Family CCCH zinc finger 0.0055
Further Details:      
 
Domain Number - Region: 395-424
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000549
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010347   Gene: ENSMMUG00000007879   Transcript: ENSMMUT00000011035
Sequence length 507
Comment pep:known chromosome:MMUL_1:7:2799079:2801319:1 gene:ENSMMUG00000007879 transcript:ENSMMUT00000011035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPAAPSEAQEAAGAQAGAEAAGEGVSGPDLPVCEPSRESAAPDSALPHAPVGWAPFPV
APVPAHLRTGGLRPAPASGGGAWRNPFPSRSSGIWTKQIICRYYIHGQCKEGENCRYSHD
LSGRKMATEGSVSPPGASAGGGPSTAAHIEPPTQEVAEAPPAASSLSLPVIGSAAERGFF
EAERDNADRGAAGGAGVESWADAIEFVPGQPYRGRWVASAPEAPPQSSETERKQMAVGRG
LRFCYYASRGVCFRGESCMFLHGDICDMCGLQALHPMDAAQREDHIRACIEAHEKDMELS
FAVQRGMDKVCGICMEVVYEKANPNDRRFGILSNCNHTFCIRCIRRWRSARQFDNRIIKS
CPQCRVTSDLVVPSEFWVEEEEEKQKLIQQYKEAMSNKACRYFAEGRGNCPFGDTCFYKH
EYPEGWGDEPPGPGGGSFGAYWHQLVEPVRMGEGDMLYKSRKKELVVLRLASLLFKRFLL
LRDELPFSEDQWDLLHYELEEYFNLNL
Download sequence
Identical sequences F7B6F3 G7PAF8
ENSMMUP00000010347 XP_001106523.1.72884 ENSMMUP00000010347 9544.ENSMMUP00000010347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]