SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010386 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010386
Domain Number 1 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.45e-22
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 2 Region: 516-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.43e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.9e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 350-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.28e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 405-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-18
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 8 Region: 558-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 9 Region: 2-49
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-16
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 10 Region: 143-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000398
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010386   Gene: ENSMMUG00000005235   Transcript: ENSMMUT00000011076
Sequence length 614
Comment pep:known_by_projection chromosome:MMUL_1:19:12137517:12140377:-1 gene:ENSMMUG00000005235 transcript:ENSMMUT00000011076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASVALGDVAVNFTREEWALLGPCQKNLYKDVMQETIRNLDCVGMKWKDQFLFKDQIEDQY
KYPRKNLRCRMLERFGESKDGSKWGEMSSQIQDSIVTKNTLTGVGPCESNMSGEIVLGHS
SLNCYIRVGAGHKPHEYHECGEKPDTHKQYGKAFSYHNSFQTPEGLHTGKKPYDCKECGK
SFSSLGNLQRHMAVQRGDGPYKCKLCGKAFFWPSLLHMHERTHTGEKPYECKQCSKAFSF
YSSYVRHERTHTGEKPYECKQCSKAFPDYSSCLRHERTHTGEKPYTCKQCGKAFSASTSL
RRHETTHTEEKPYACQQCGKAFHHLGSFQRHMVTHTRDGPHKCKICGKGFDCPSSLQSHE
RTHTGEKLYECKQCGKALSHSSSFRRHMTMHTGDGPHKCKICGKAFVYPSVFQRHEGTHT
AEKPYKCKQCGKAYRISSSLRRHETTHTGEKPYKCKCGKAFIDFYSFQNHKTTHAGEKPY
ECKECGKAFSCFQYLSQHKKTHTGEKPYECKTCRKAFSHFGNLKVHERIHSGEKPYECKE
CGKAFSWLTCFLRHERIHMREKSYECQQCGKAFTHSRFLQGHEKTHTGENPYECKECGKA
FASLNSLHRHKKTH
Download sequence
Identical sequences ENSMMUP00000010386 9544.ENSMMUP00000010386 ENSMMUP00000010386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]