SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010387 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010387
Domain Number 1 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.85e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.43e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-20
Family KRAB domain (Kruppel-associated box) 0.00071
Further Details:      
 
Domain Number 5 Region: 389-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 484-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-18
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 7 Region: 540-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-18
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 346-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.44e-16
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 139-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000567
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 10 Region: 444-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000186
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010387   Gene: ENSMMUG00000007912   Transcript: ENSMMUT00000011077
Sequence length 589
Comment pep:known chromosome:MMUL_1:19:12036187:12039782:-1 gene:ENSMMUG00000007912 transcript:ENSMMUT00000011077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDSVAFEDVAVNFTHEEWALLGPSQKNLYRDVMRETIRNLNCVGMKWENQNIDDQYQNLR
RNPRCDVVERFGKSKDGSQCEETLSQIRNSTVNKNTPARVDACESSVNGEVIMGHSSLNC
YIRVDTGHKHRECHEYAEKPYTHKQCGKGLSYRHSFRTRERPYTGKKPYDCKECGKTFSS
PGNLRRHMVVQGGDGPYKCELCGKAFFWPSLLRMHERTHTGEKPYECKHCSKAFPVYSSY
LRHEKIHTGEKPYECKQCSKAFPDYSSYLRHERTHTGEKPYKCEQCGKAFSVSGSLRVHE
RIHTGEKPYTCKQCGKAFCHLGSFQRHMIMHSGDGPHKCKICGKGFDFPGSARIHEGTHT
LEKPYECKQCGKLLSYRSSFRRHMMAHAGDGPHKCMVCGKAFDSPSVFQRHERTHTGEKP
YECKQCGKAFRISSSLRKHETTHTGEQPYKCKCGKAFSDFFSFQSHETTHSEEEPYECKE
CGKAFSSFKYFCRHERTHSEEKSYECQTCGKAFSRFSYLKTHERTHTAEKPYECKQCRKA
FFWPSFLLRHERTHTGERPYECKHCGKAFSRSSFCREHERTHTGEKPYE
Download sequence
Identical sequences ENSMMUP00000010387 ENSMMUP00000010387 9544.ENSMMUP00000010387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]