SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010392 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010392
Domain Number 1 Region: 204-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 2 Region: 264-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-20
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 345-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 2-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.18e-17
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 5 Region: 162-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000265
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 307-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000287
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010392
Domain Number - Region: 136-171
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00032
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number - Region: 83-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00303
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010392   Gene: ENSMMUG00000007914   Transcript: ENSMMUT00000011082
Sequence length 457
Comment pep:known_by_projection chromosome:MMUL_1:19:12087220:12091675:-1 gene:ENSMMUG00000007914 transcript:ENSMMUT00000011082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTVAFEDVAVNFTQEEWALLGPSQKNLYRYVMQETIRNLDCIRKIWEGQNTEDQKKNPRR
NLRCHMLERFSESKDSSQCGETFSLIRGSIVNNSICPGEDPCQSTECEEVIMGHLSLNSH
IRVDAGYKPCEYQEYGEKPHTHKQRGKAFSYHHSFPSRGRPHTGKKRYECKECGKTFSSR
RNLRRHMVVQGGNRPYKCKLCGKAFFWPSLLRMHERTHTGEKPYECKQCSKAFPFYSSYL
RHERMHTGEKPYECKQCSKALPVSSSYIRHERTHTGEKRYVCKQCGKAFSVSSSLRRHET
THSAEKPYECKQCRKAFHHLGSFQIHMKRHTGDRPHKCKICGKGFDRPSLVRYHERIHTG
EKPYECKQCGKALSHSSSFRRHMVMHTGDGPNKCKVCGKAFVYPSVCQRHEKTHWRAGRG
KPYKCKCGKAFHNFYSFQNHETTHTGEILYECKECGK
Download sequence
Identical sequences 9544.ENSMMUP00000010392 ENSMMUP00000010392 ENSMMUP00000010392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]