SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010527 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010527
Domain Number 1 Region: 90-221
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.23e-43
Family Glutathione S-transferase (GST), C-terminal domain 0.000000177
Further Details:      
 
Domain Number 2 Region: 7-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.2e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.00000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010527   Gene: ENSMMUG00000008029   Transcript: ENSMMUT00000011231
Sequence length 225
Comment pep:known chromosome:MMUL_1:1:112800849:112804854:-1 gene:ENSMMUG00000008029 transcript:ENSMMUT00000011231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLD
FPNLPYLMDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCY
SSDHEKLKPQYLEELPGQLKQFSVFLGKFSWFAGEKLTFVDFLTYDILDQNRIFEPKCLD
EFPNLKAFMCRFEALEKIAAYIQSDQFFKMPINNKMAQWGNKPVC
Download sequence
Identical sequences A0A2K6E831 F7H5D7 Q2PFL7 Q9BEA9
ENSMMUP00000010527 9544.ENSMMUP00000010527 NP_001248509.1.72884 NP_001271791.1.63531 XP_011735495.1.29376 ENSMMUP00000010527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]