SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010723 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010723
Domain Number 1 Region: 53-165
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000614
Family Cadherin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010723   Gene: ENSMMUG00000008189   Transcript: ENSMMUT00000011441
Sequence length 275
Comment pep:known_by_projection chromosome:MMUL_1:3:143421352:143447713:1 gene:ENSMMUG00000008189 transcript:ENSMMUT00000011441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTGAIQVAQMIHRDAGELRQNPTISLEVLVKDRLYGGQENHIQITFIVEDISNNPATCQR
FTFRINRCELTAKGTLLLVLNKFCFDDDREVPNNRFNFTMPSGVGSGGRFLQDPAGSGKI
VLIGDLDYENPSNLAAGNKYTVIIQVQDVAPPYYKSKRNIYIYILTSPENEFPLIFDRPS
YVFDVSERRLAQGHLPGPEEKRLLSIRMVCAFCHHFGLHIASGSPGVPGCPIGQRHPQTL
CLQDWEEKGTSNNSLLNEDCKERRCGGNYPDEQSL
Download sequence
Identical sequences ENSMMUP00000010723 9544.ENSMMUP00000010723 ENSMMUP00000010723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]