SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010813 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010813
Domain Number 1 Region: 581-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.36e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 637-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.23e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 4 Region: 526-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-23
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 5 Region: 469-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-22
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 6 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-22
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 683-735
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 8 Region: 361-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-19
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 9 Region: 304-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-16
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 10 Region: 260-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000772
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 11 Region: 194-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000454
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010813   Gene: ENSMMUG00000008253   Transcript: ENSMMUT00000011534
Sequence length 740
Comment pep:known chromosome:MMUL_1:20:29961234:29987396:1 gene:ENSMMUG00000008253 transcript:ENSMMUT00000011534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLLTFRDVAVEFSLEEWEHLEPAQKTLYQDVMLENYRNLVSLGLLVSKPDLITFLEQRKE
PWNVKREETVAVQPDVFSHYNKDLLTEQCTEASFQKVVSRRHGNCHLENLHLRKRWKRSC
DGHNGCYDEKTFKYDQFDESSVESLFHQQILSSCAKSYNFDQYRVFTHSSLFNQQEEIDI
WGKHHIHDKTSELFRQVSTLSRYRDVFIAEKNYHCNNSEKTLNQSSSPKNHQENCFLEKQ
CKCKEFEKVFLQSMHGQEKQEQSYKCNKCVEVCAQSLKHIQHQTIHIRENSYRCNKYDKD
LSQSSNLRKQIIHNEEKPYKCEKCGDSFNHSLHLTQHQIIPTEEKPYKWKECGKVFNLNC
SLYLTKQQQIDTGENLYKCKACSKSFTRSSNLIVHQRIHTGEKPYKCKECGKAFRCSSYL
TKHKRIHTGEKPYKCKECGKAFNRSSCLTQHQTTHTGEKLYKCKVCSKSYARSSNLIMHQ
RVHTGEKPYKCKECGKVFSRSSCLTQHRKIHTGENLYKCKVCAKPFTCFSNLIVHERIHT
GEKPYKCKECGKAFPYSSHLIRHHRIHTGEKPYKCKACSKSFSDSSGLTVHRRTHTGEKP
YTCKECGKAFSYSSDVIQHQRIHTGQRPYKCEECGKAFNYRSYLTTHQRSHTGERPYKCE
ECGKAFNSRSYLTTHRRSHTGERPYKCDECGKAFSYRSYLTTHRRSHSGERPYKCEECGK
AFNSRSYLITHQRSHTREKL
Download sequence
Identical sequences ENSMMUP00000010813 ENSMMUP00000015854 9544.ENSMMUP00000010813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]