SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011034 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011034
Domain Number 1 Region: 133-272
Classification Level Classification E-value
Superfamily ISP domain 2.62e-40
Family Rieske iron-sulfur protein (ISP) 0.000000764
Further Details:      
 
Domain Number 2 Region: 78-146
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 1.22e-22
Family ISP transmembrane anchor 0.0000348
Further Details:      
 
Domain Number 3 Region: 1-56
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 9.48e-16
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011034   Gene: ENSMMUG00000008417   Transcript: ENSMMUT00000011767
Sequence length 273
Comment pep:known chromosome:MMUL_1:19:35679449:35684319:-1 gene:ENSMMUG00000008417 transcript:ENSMMUT00000011767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPKPPVLLKRPFLSRESLSGQAVR
RPLVASVGLNVPASVCYSHTDVKVPDFYDYRRLEVLDSTKSSRESSEARKGFSYMVTAVT
TVSVAYAAKNVVTQFISTMSASADVLAMAKIEIKLSDIPEGKNMTFKWRGKPLFVRHRTQ
KEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGFYCPCHGS
HYDASGRIRLGPAPLNLEVPPYEFTSDDMVVVG
Download sequence
Identical sequences ENSMMUP00000011034 ENSMMUP00000011034 9544.ENSMMUP00000011034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]