SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011093 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011093
Domain Number 1 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 3-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 236-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.91e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 180-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-22
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 7 Region: 515-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-21
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 8 Region: 571-628
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 141-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000128
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 10 Region: 479-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000454
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 11 Region: 395-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000483
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011093   Gene: ENSMMUG00000005242   Transcript: ENSMMUT00000011827
Sequence length 641
Comment pep:novel scaffold:MMUL_1:1099548049741:178114:195172:1 gene:ENSMMUG00000005242 transcript:ENSMMUT00000011827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCFFQRLLTFRDVAIEFSVEEWQCLDTAQQDLYRNVMLENYRNLVSLGIAVSKPELITCL
EERKEPWNAKSEAVRTERIQSRQYKIRSQVLGSTTKSASCGAVILSFLKACFTGDQNPSF
ETSKPEVSIRLNQSLSTTHSKIFQCNKCVKVFSKLSDLNRHKIRHTGEKPFRCKACGKFF
HMFSLLTQHQRIHTRESPYKCEEYGKAFNWPSNLVKHERIHTGEKPHKCDECGKGFLQSA
NLIIHKRIHTGETPYKCDECDKAFKCISVLTKHKRIHTGEKPYKCEDCGKAFKWFSTFSS
HKRIHTGEKPYICKECGKAFKEASYLSGHKKIHTGEKPYKCEECGKAFMWVSCLTRHMRT
HTGEKPYNCDECGKAFKYSSNLNAHKKTHTGEKAYKCGECGKAFKYRSTLSKHKRIHCGG
KPYKCDECSKAFKSTSDLTKHKIIHTGEKPYKCEDCGKAFKWFSILTRHKRIHTGEKLYI
CKGCGKAFKQASVLNGHKKVHTGEKPHKCEECGKAFKWLSCLTRHKRSHTEEKPCTCDEC
GKAFKYSSNLNEHKKIHTVEKPYKCEECGKAFKCHSSVTDHKRIHTGERPYKCKECDKIF
NWASSLLKHKRIHTGRISYKCEECGKAFTSCSSLSNHKILH
Download sequence
Identical sequences ENSMMUP00000011093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]