SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011095 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011095
Domain Number 1 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-24
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 246-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-23
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 458-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 2-49
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.45e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 208-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000167
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 510-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000153
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 293-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000114
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 9 Region: 377-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000152
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011095
Domain Number - Region: 99-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00105
Family Classic zinc finger, C2H2 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011095   Gene: ENSMMUG00000008458   Transcript: ENSMMUT00000011829
Sequence length 543
Comment pep:known_by_projection chromosome:MMUL_1:19:2783307:2788227:-1 gene:ENSMMUG00000008458 transcript:ENSMMUT00000011829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSVVFEEVAVNFTPEEWALLDHAQRSLYRDVMLETCRNLASLDCCIYVRTSGSSSQRDVL
GNGISNDEEIVKFTSDYWSIFGENWRFDNTGDQHQIPERHLRSQLGSLCESNEGHQCGET
WSQTANLPVHKSYPTEAQPSECTKCGKASENQQRSHTRQRLCKECGQACSCLSCHSPPMK
TQTVEKPCNGQDSGRASARYVKSLSSKKSYECKKCGKAFACPSSFRGHVNSHHEQKTHAC
KVCGKTFMYYSYLTRHLRTHTGEKPYECKECGKAFSCPSYFREHVRTHTGEKPYECKHCG
KSFSCYSSFRDHVRTHTGEKPCQCKHCGKAFTCYSSLREHGRTHSGEKPYECKECGKAFR
YPSSLRAHMRMHTGEKPYVCKQCGKAFGCPTYFRRHVKTHSGVKPYECKECGKAYSFSSS
LRIHVRTHTGEKPFECKHCEKAFSCHSSLREHVRTHSGEKPYECNQCGKAFSHAQYFQKH
VRSHSGVKPYECPECGKAYSCSSSLRVHVRTHTGERPYECKQCGKTFRYLASLQAHVRTH
AVA
Download sequence
Identical sequences ENSMMUP00000011095 ENSMMUP00000011095 9544.ENSMMUP00000011095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]