SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011304 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011304
Domain Number 1 Region: 92-262,309-380
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-36
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1157-1411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.51e-34
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 837-992,1032-1108
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.98e-28
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 4 Region: 591-728
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000011
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011304
Domain Number - Region: 1419-1498
Classification Level Classification E-value
Superfamily EF-hand 0.00191
Family Calmodulin-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011304   Gene: ENSMMUG00000008618   Transcript: ENSMMUT00000012051
Sequence length 1924
Comment pep:known chromosome:MMUL_1:X:47057352:47085193:-1 gene:ENSMMUG00000008618 transcript:ENSMMUT00000012051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESEGRKDTTPEPSPANGAGPGPEWGLFPGPPAVEGESSGASGLGTPKRRNQHSKHKTV
AVASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDS
NTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLL
EQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHI
ALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDLEAEEDPSPCASSGSGRACTLNQTECR
GRWPGPNGGITNFDNFFFAMLTVFQCVTMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGS
FFVLNLVLGVLSGEFSKEREKAKARGDFQKQREKQQMEEDLRGYLDWITQAEELDMEDPS
ADGNLGWPQLTELTNRRRGRLRWFSHSTRSTHSTSSHASLPASDTGSMTETQGDEDEEEG
ALASCTRCLNKIMKTRVCRRLRRANRVLRARCRRAVKSNACYWAVLLLVFLNTLTIASEH
HGQPVWLTQIQGTPPACQSSPPASYSFYPRSLNPGPLRCGASAPKTLPFPPNKSRALSLF
HPTLHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRST
FDTFPQALLTVFQILTGEDWNVVMYDGIMAYGGPFFPGMLVCIYFIILFICGNYILLNVF
LAIAVDNLASGDAGTAKDKGGEKSSEKDLPPENEGLVPGVEKEEEEGTRREGADHPENNR
LATFGNIEVKEEGAGGVELLQEVVPKEKVVPIPEGSAFFCLSQTNPLRKGCHTLIHHHVF
TNLILVFIILSSVSLAAEDPIRAHSFRNHILGYFDYAFTSIFTVEILLKMTVFGAFLHRG
SFCRSWFNMLDLLVVSVSLISFGIHSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCV
FVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYTCTDEAKHTPQECKGSFLVYPDGDVS
RPLVRERLWVNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDAYAEDHGPIYNYRVEI
SVFFIVYIIIIAFFMMNIFVGFVIITFRAQGEQEYQNCELDKNQRQCVEYALKAQPLRRY
IPKNPHQYRVWATVNSAAFEYLMFLLILLNTVALAMQHYEQTAPFNYAMDILNMVFTGLF
TIEMVLKIIAFKPKHYFTDAWNTFDALIVVGSVVDIAVTEVNNGGHLGESSEDSSRISIT
FFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIAMIFFIYAVIGMQMFGKVA
LQDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLASLPGNRCDPESDFGPGEEFTCG
SNFAIAYFISFFMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPGA
KGHIKHLDVVALLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVTFNATLFALVRT
SLKIKTEGNLEQANQELRIVIKKIWKRMKQKLLDEVIPPPDEEEVTVGKFYATFLIQDYF
RKFRRRKEKGLLGNEAAPSTSSALQAGLRSLQDLGPEMRQALTYLETNKATMVSQPPSRR
GSRISVSLPVGDRLPDSLSLGPSDDDRGTPTSSQPSVPQAGSNTHRRGSGALIFTIPEEG
NSQPKGTRGQDKQDEDEEVPDRLSYLDEQAGTPPYPVLLPPHRAQRYMDGHLAPRRRLLP
PTPAGRKPSFTIQCLQRQGSCEDLPIPGTYHRGRNSGPNRAQGSWATPPQRGRLLYAPLL
LVEEGAAGEGYLGRSSGPLRTFTCLHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFAR
DPRFVALAKQEIADACRLTLDEMDSAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMAC
VHAL
Download sequence
Identical sequences ENSMMUP00000011304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]