SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011427 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011427
Domain Number 1 Region: 19-351
Classification Level Classification E-value
Superfamily Diaminopimelate epimerase-like 2.62e-102
Family Proline racemase 0.000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011427   Gene: ENSMMUG00000008717   Transcript: ENSMMUT00000012182
Sequence length 367
Comment pep:known_by_projection chromosome:MMUL_1:7:122497291:122509122:-1 gene:ENSMMUG00000008717 transcript:ENSMMUT00000012182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESALAVSRLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDH
VRRRLMFEPRGHRDMYGAVLVPSELQDAHLGVLFLHNEGYSSMCGHAVLALGRFALDFGL
VPAPAAGTREARVNIHCPCGLVTAFVACEDGRSHGPVRFHSVPAFVLATDLMVDVPGHGK
VVVDIAYGGAFYAFVSAEKLGLDICSAKTRDLVDAASTVTEAVKAQFKINHPDSEDLAFL
YGTILTDGKDAYTKEPTTNICVFADEQVDRSPTGSGVTARIALQYHKGLLELNQTRAFKS
STTGSVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIVEDDDPLRDGFSSQVTSSMI
LRAFFLK
Download sequence
Identical sequences 9544.ENSMMUP00000011427 ENSMMUP00000011427 ENSMMUP00000011427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]