SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011500 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011500
Domain Number 1 Region: 5-222
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.61e-66
Family Glutathione peroxidase-like 0.00000000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011500   Gene: ENSMMUG00000008776   Transcript: ENSMMUT00000012261
Sequence length 224
Comment pep:known chromosome:MMUL_1:1:203122747:203133352:1 gene:ENSMMUG00000008776 transcript:ENSMMUT00000012261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGLLLGDEAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPE
FAKRNVKLIALSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDKNRDLAILLGMLDPA
EKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD
WKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
Download sequence
Identical sequences A0A096NR25 A0A0D9RH37 A0A2K5MH93 A0A2K5UQC3 A0A2K6ASN2 A0A2K6L1I2 A0A2K6R212 F7F6H0
ENSPANP00000015495 NP_001253014.1.72884 XP_010365666.1.97406 XP_011744287.1.29376 XP_011941302.1.92194 XP_017722406.1.44346 ENSMMUP00000011500 9544.ENSMMUP00000011500 ENSMMUP00000011500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]