SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011535 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011535
Domain Number 1 Region: 643-779
Classification Level Classification E-value
Superfamily EF-hand 0.00000000143
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 2 Region: 473-526,563-687
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000353
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011535   Gene: ENSMMUG00000008795   Transcript: ENSMMUT00000012297
Sequence length 969
Comment pep:known_by_projection chromosome:MMUL_1:5:80973279:81042399:1 gene:ENSMMUG00000008795 transcript:ENSMMUT00000012297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLATPGGLRDQRGLEIEMQRIR
QAAARDPPAGASASPSPPLSSCSRQAWSRDNPGFEAEEEEEEEVEGEEGGMVVEMDVEWR
PGSRRSAASSAVSSAGARGRGLGGYHSAGHPSGRRRRREDQGPPCPSPAGGGDPLHRHLP
LDGQAPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTY
GMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSN
QTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFG
PRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGT
RATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEII
FCFFILYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGISIYRTSNVEVLLQFL
EDQNTFPNFEHLAYWQIQFNSIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFG
FAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPI
YFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKK
NTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMR
DDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEF
QVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSE
IHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSHPSSSQSTEGMEGAG
GNGSSNVHV
Download sequence
Identical sequences 9544.ENSMMUP00000011535 XP_001099242.1.72884 ENSMMUP00000011535 ENSMMUP00000011535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]