SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011558 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011558
Domain Number 1 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-21
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 2 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 428-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-19
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 5 Region: 34-90
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-19
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 6 Region: 525-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.62e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.08e-18
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 8 Region: 373-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-18
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 166-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000263
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011558   Gene: ENSMMUG00000008815   Transcript: ENSMMUT00000012323
Sequence length 580
Comment pep:known chromosome:MMUL_1:19:11549774:11566252:-1 gene:ENSMMUG00000008815 transcript:ENSMMUT00000012323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RERRPGRSVSASVSPGPTLAYREDTRTPRSREMDSVAFEDVAVNFTQEEWALLGPSQKSL
YRNVMQETIRNLDCIETKWEDQNIGDQCQNPRRNLRSHTCEIKDDSQCGETFGHVPDSIV
NKNTPQVNPCDSSGCGEVAMGHSSLNCNIRVDTGHKSCEHQEYGEKPYTHKQRGKTINHQ
HSFQTHERPPTGKKPFDCKECAKTFSSLGNLRRHMAAHHGDGPYKCKLCGKAFVWPSLFH
LHERTHTGEKPYECKQCSKAFPFYSSYLRHERIHTGEKAYECKQCSKAFPDYSTYLRHER
THTGEKPYKCTQCGKAFSCYYYTRLHERTHTGEQPYACQQCGKTFYHHTSFRRHMIRHTG
DGPHKCKICGKGFDCPSSVRNHETTHTGEKLYECKQCGKVLSHSSSFRSHMITHTGDGPQ
KCKICGKAFGCPSLFQRHERTHTGEKPYQCKQCGKAFSLSGSLRRHEATHTGVKPYKCKC
GKAFSDLSSFQNHETTHTGEKPYECKECGKAFSCFKYLSQHKRIHTVEKPYECKTCRKAF
SHFSNLKVHERIHSGEKPYECKECGKAFSWLTCLLRHERI
Download sequence
Identical sequences ENSMMUP00000011558 9544.ENSMMUP00000011558 ENSMMUP00000011558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]