SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011603 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011603
Domain Number 1 Region: 32-160
Classification Level Classification E-value
Superfamily PH domain-like 3.42e-27
Family Phosphotyrosine-binding domain (PTB) 0.0091
Further Details:      
 
Domain Number 2 Region: 286-406
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000263
Family SH2 domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011603   Gene: ENSMMUG00000008847   Transcript: ENSMMUT00000012371
Sequence length 441
Comment pep:known chromosome:MMUL_1:1:23384942:23393892:-1 gene:ENSMMUG00000008847 transcript:ENSMMUT00000012371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPLLWSWKPGTPGAMQKAGAGGRRASDCGLAPHRPRCITKFAQYVGSFPVDDLDTQESVW
LVQQQLWALKDCPRRRAVILKFNLQGLKIYSGEGEVLLMAHALRRILYSTWCPADCQFAF
VARNPRSPASKLFCHLFVGSQPGEVQILHLLLCRSFQLAYLLQHPEERALPEPCPGPTGV
VPLKSLSSSGGPPGGLVREPFGCDQLSQNVHALVSFRRLPAEGLVGSGKELPESEGRARH
ARLGNPYCSPTLVRKKAIRSKVIRSGAYRGCTYETQLQLSAREAFPTAWEAWPRGPGGHS
CLVESEGSLTENIWAFAGISRPCALALLRRDVLGAFLLWPEPGASGQWCLSVHTQCGVVP
HQVFRNHLGRYCLEHLPAEFPSLEALVENHAVTERSLFCPLDMGRLNPTYEEQDCGPPGR
PPRTLRPLSHAKSEAELQGLG
Download sequence
Identical sequences G7MHE4 G7NUU9
ENSMMUP00000011603 ENSMMUP00000011603 9544.ENSMMUP00000011603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]