SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011635 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011635
Domain Number 1 Region: 324-402
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.53e-25
Family Intermediate filament protein, coiled coil region 0.0000415
Further Details:      
 
Domain Number 2 Region: 92-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000134
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 98-207
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000759
Family Myosin rod fragments 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011635   Gene: ENSMMUG00000008872   Transcript: ENSMMUT00000012406
Sequence length 499
Comment pep:known chromosome:MMUL_1:9:102968236:102981691:1 gene:ENSMMUG00000008872 transcript:ENSMMUT00000012406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSL
GLGLAYRRPPASEGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNR
ALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARAQALLERDGLAEEVQRLRA
RCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLA
TLQASSQAAAEVDVAVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR
STEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQ
LENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPL
PNPSYLLPPRILSSATSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVIS
TKKTEKSNIEETTISSQKI
Download sequence
Identical sequences A0A096P6G7 A0A2K5N141 A0A2K5TNS1 A0A2K6DWL8 F7DY27
ENSMMUP00000011635 ENSPANP00000020942 ENSMMUP00000011635 9544.ENSMMUP00000011635 NP_001253499.1.72884 XP_005566388.1.63531 XP_011733782.1.29376 XP_011907093.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]