SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011753 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011753
Domain Number 1 Region: 256-365
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.71e-49
Family Calsequestrin 0.00000345
Further Details:      
 
Domain Number 2 Region: 24-145
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.88e-19
Family Calsequestrin 0.000024
Further Details:      
 
Domain Number 3 Region: 146-206
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000224
Family Calsequestrin 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011753   Gene: ENSMMUG00000008970   Transcript: ENSMMUT00000012534
Sequence length 399
Comment pep:known_by_projection chromosome:MMUL_1:1:118681702:118751385:-1 gene:ENSMMUG00000008970 transcript:ENSMMUT00000012534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRTHLFIVGVYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPV
SSDKVAQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEKGSLYVLKGD
RTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDHIKLIGFFKSEDSEYYK
AFEEAAEHFQPYIKFFATFDKGVSTYETPIPTLLLCASVFIPASTLLPTSPVSIPASESL
SQAQSFVSLQSVTFDSFLIQEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDL
SILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDW
IEDVLSGKINTEDDDEDDDDDDDNNSDEDNDDSDDDDDE
Download sequence
Identical sequences 9544.ENSMMUP00000011753 ENSMMUP00000011753 ENSMMUP00000011753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]