SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011760 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011760
Domain Number 1 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 450-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.65e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 391-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.33e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 545-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.16e-21
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 6 Region: 9-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-20
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 7 Region: 353-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 269-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.74e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 169-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000119
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011760   Gene: ENSMMUG00000008975   Transcript: ENSMMUT00000012541
Sequence length 606
Comment pep:known scaffold:MMUL_1:1099548049453:4801:22291:-1 gene:ENSMMUG00000008975 transcript:ENSMMUT00000012541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGRREARPQVSLTFEDVAVLFTRDEWRKLVPSQRNLYRDVMLENYRNLVALGKEVSPV
ETEFENWDSSAPPSLNKSGSGATKLGRSKSSHKTTKSTQTQDSSFQGLILKRSNRNVPWD
LKLEKPYIYEGRIEKKQDKKGSFQIVSATHKKIPSIERSHKNTELSQNFSPKSVLIRQQI
LPRDKTPPKCEIQGNSFKQNSHLLNQPKITADKRYKCSMCEKTFINTSSLRKHEKNHSGE
KLFKCKECSKAFSQSSALIQHQITHTGEKPYICKECGKAFTLSTSLYKHLRTHTVEKSYR
CKECGKSFSRRSGLFIHQKIHAEENPFKYNPGRKASSCSTSLSGCQRIHSRKKSYLCNEC
GNTFKSSSSLRYHQRIHTGEKPFKCSECGRAFSQSASLIQHERIHTGEKPYRCNECGKGF
TSISRLNRHRIIHTGEKFYNCNECGKALSSHSTLIIHERIHTGEKPCKCKVCGKAFRQSS
ALIQHQRMHTGERPYKCNECGKTFRCNSSLSNHQRIHTGEKPYRCEECGISFGQSSALIQ
HRRIHTGEKPFKCNTCGKTFRQSSSRIAHQRIHTGEKPYECNTCGKLFNHRSSLTNHYKI
HIEEDS
Download sequence
Identical sequences ENSMMUP00000011760 9544.ENSMMUP00000011760 ENSMMUP00000011760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]