SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011907 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011907
Domain Number 1 Region: 5-123
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-29
Family Cadherin 0.0008
Further Details:      
 
Domain Number 2 Region: 117-183
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000123
Family Cadherin 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011907   Gene: ENSMMUG00000009078   Transcript: ENSMMUT00000012697
Sequence length 230
Comment pep:known_by_projection chromosome:MMUL_1:14:90929608:91140783:1 gene:ENSMMUG00000009078 transcript:ENSMMUT00000012697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRD
GSGLGRFSIDDESGVITAADILDRETTGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDN
APLTSEPIYYPVVMENSPKDISVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGK
GMLRQAGMQWHDHSSLQSRTPGFKGYPCLSLLSSWDSQHALPCPANVLNS
Download sequence
Identical sequences ENSMMUP00000011907 9544.ENSMMUP00000011907 ENSMMUP00000011907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]