SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012013 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012013
Domain Number 1 Region: 345-407
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.19e-22
Family LIM domain 0.0071
Further Details:      
 
Domain Number 2 Region: 404-466
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.01e-18
Family LIM domain 0.0024
Further Details:      
 
Domain Number 3 Region: 463-525
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.07e-18
Family LIM domain 0.0035
Further Details:      
 
Domain Number 4 Region: 522-551
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000879
Family LIM domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012013
Domain Number - Region: 318-343
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00212
Family LIM domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012013   Gene: ENSMMUG00000009159   Transcript: ENSMMUT00000012811
Sequence length 552
Comment pep:novel chromosome:MMUL_1:11:121214029:121225962:-1 gene:ENSMMUG00000009159 transcript:ENSMMUT00000012811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILD
PLDQWQPSGSRFIHQQPQSSSPVYGSSAKTSSASNPQDSVGSPCSRVGEEEHVYSFPNKQ
KSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPHYGVP
ETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSS
PQRVTSTQQQTRISASSATRELDELMASLSDFKFMAQGKTGSSSPPGGPPKPGSQLDSML
GSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGRRHPEHFVCTHCQEEIGSRNFFER
DGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKD
GKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDG
QPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDK
PYCQNCFLKLFC
Download sequence
Identical sequences ENSMMUP00000012013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]