SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012035 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012035
Domain Number 1 Region: 11-120
Classification Level Classification E-value
Superfamily Immunoglobulin 6.51e-21
Family V set domains (antibody variable domain-like) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012035   Gene: ENSMMUG00000009184   Transcript: ENSMMUT00000012838
Sequence length 239
Comment pep:known chromosome:MMUL_1:1:197501609:197521161:1 gene:ENSMMUG00000009184 transcript:ENSMMUT00000012838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTDETGGLTSVTWSFQPEGADTTVSFFHY
SQGQVYPGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHI
RLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLS
PVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
Download sequence
Identical sequences 9544.ENSMMUP00000012035 ENSMMUP00000012035 ENSMMUP00000012035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]