SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012188 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012188
Domain Number 1 Region: 102-166
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.43e-25
Family SCAN domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012188   Gene: ENSMMUG00000009306   Transcript: ENSMMUT00000013004
Sequence length 179
Comment pep:known chromosome:MMUL_1:10:28568785:28569668:1 gene:ENSMMUG00000009306 transcript:ENSMMUT00000013004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATEPILGATGSPAAVPPEKPEGAGSSSDPELNSVGSSLPKASPPAPEPSSPNAAVPEA
IPTPRAAASAARELPLGPAPVSIAPQAEAETRSPPGPAGSRLGPETFRQRFRQFRYQDAA
GPREAFRQLRELSRQWLRPDIRTKEQIVEMLVQEQLLAILPEAARARRVRRRTDVRITG
Download sequence
Identical sequences F7H1F7
9544.ENSMMUP00000012188 NP_001177837.1.72884 ENSMMUP00000012188 ENSMMUP00000012188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]