SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012289 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012289
Domain Number 1 Region: 571-711
Classification Level Classification E-value
Superfamily PH domain-like 3.28e-46
Family Phosphotyrosine-binding domain (PTB) 0.0000167
Further Details:      
 
Domain Number 2 Region: 427-557
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-21
Family SH2 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012289   Gene: ENSMMUG00000009386   Transcript: ENSMMUT00000013111
Sequence length 716
Comment pep:known_by_projection chromosome:MMUL_1:16:50591753:50612228:-1 gene:ENSMMUG00000009386 transcript:ENSMMUT00000013111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQVMSSPLLAGGHAVSLAPCDEPRRTLHPAPSPSLPPQCSYYTTEGWGAQALMAPVPCM
GPPDRLQQAPQAQAKATCFLPSPGEQALGTPEDLDSYIDFSLESLNQMILELDPTFQLLP
QGTGGPRAEPAQSTMSVRKKEEPEALDIKYIEVTSARSRCHDGPQRCSSPSVTPPFGSPR
SGGLLLSRDVPRETRSSSESLIFSGNQGRGHQRPLPPSEGLSPQPPNSPSISIPCMGSKA
LSPHGLGSPLVASPRLEKRLGGLAPQRASRISVLSASPASDVSYMFGSSQSLLHSSNSSH
QSSSRSLESPASSSSSLHSLGSVSLCTRPSDFQAPRNPTLTMGQPRAPHCPPLAKEHASS
CPPSITNSMVDIPIVLINGCPEPGSSPPQWSPGHQSSVRPGAASPSNQVCPGTRSHSQTL
SDAPFTTCPEGPTRDMQPTMKFVMDTSKYWFKPNITREQAIELLRKEEPGAFVIRDSSSY
RGSFGLALKVKEVPPSAQNRPGEDSNDLIRHFLIESSAKGVHLKGADEEPYFGSLSAFVC
QHSIMALALPCKLTIPQRELGGADGASDSTDSPASCQRKSAGCHTLYLSSVSVETLTGAL
AVQKAISTTFERDVLPTPTVVHFKVTEQGITLTDVQRKVFFRRHYPLTTLRFCGMDPEQR
KWQKYCKPSWIFGFVAKSQTEPQENVCHLFAEYDTVQPASQVISLVTALLQDVERM
Download sequence
Identical sequences 9544.ENSMMUP00000012289 ENSMMUP00000025485 ENSMMUP00000012289 XP_014975077.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]