SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012405 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012405
Domain Number 1 Region: 98-244
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.66e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.0000053
Further Details:      
 
Domain Number 2 Region: 26-96
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012405   Gene: ENSMMUG00000009482   Transcript: ENSMMUT00000013235
Sequence length 247
Comment pep:known chromosome:MMUL_1:X:153288181:153325203:-1 gene:ENSMMUG00000009482 transcript:ENSMMUT00000013235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLRPSTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEE
LKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKF
SAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPTVSRRLFLDGDQLT
LADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTYTCPEDKEIENTYA
SVAKQKS
Download sequence
Identical sequences F6YUR9
ENSMMUP00000012405 9544.ENSMMUP00000012405 NP_001253811.1.72884 ENSMMUP00000012405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]