SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012522 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012522
Domain Number 1 Region: 23-296
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.04e-35
Family G proteins 0.0015
Further Details:      
 
Domain Number 2 Region: 305-440
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 1.07e-28
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012522   Gene: ENSMMUG00000009577   Transcript: ENSMMUT00000013366
Sequence length 548
Comment pep:known chromosome:MMUL_1:7:113647046:113691664:1 gene:ENSMMUG00000009577 transcript:ENSMMUT00000013366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVS
VAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEVFL
INKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQ
LFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQ
NVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLD
IKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKM
EEICGGDKPFLAPNDLQSKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQ
YIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTW
AYIRYSGEYRELGAVIDQVAAALWDQEKNFTSALYKLYSAAATHRHLYHQAFPTPKSEST
EQSEKKKM
Download sequence
Identical sequences ENSMMUP00000012522 9544.ENSMMUP00000012522 ENSMMUP00000012523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]