SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013116 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013116
Domain Number 1 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 2-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 4 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 517-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000012
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013116   Gene: ENSMMUG00000010035   Transcript: ENSMMUT00000014007
Sequence length 586
Comment pep:known chromosome:MMUL_1:3:60194324:60225281:-1 gene:ENSMMUG00000010035 transcript:ENSMMUT00000014007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLTFRDVKIEFSLEEWQCLDTAQRNLYRDVMLENYRNLVFLGIAVSKPDLITWLEQGK
EPWNMKRREMVDKTPVMCSHFTQDVWPEQSIKDSFQKVILRTCGKYGHENLQLRKDHKSV
DACKVYKGGYNGLNQCLTTTESKIFQCDKYVKVFHKFSNVNRSKIRHTGKKPFKCKNRGK
SFCMLSQLTQHKKIHTREYSYKCEECGKAFNWSSTLTKHKIIHTGEKPYKCEECGKAFNR
SSNLTKHKIIHTGEKPYKCEECGKAFNRSSTLTKHKRIHTEEKPYKCEECGKAFNQFSIL
NKHKRIHMEDKPYKCEECGKAFRVFSILKKHKIIHTGEKPFKCEECGKAFNQFSNLTKHK
IIHTGEKPYKCDECGKAFNQSSTLTKHKRIHTGEKPYKCEECGKAFKQSSTLTEHKIIHT
GEKPYKCEECGKAFSWSSAFTKHKRNHMEDKPYKCEECGKAFSVFSTLTKHKIIHTREKP
YKCEECGKAFNQSSIFTKHKINHTEGKSYKCEKCGNAFNQSSNLTAHKIVYTGEKPYKYE
ECDKAFNNFSTLITHQIIYTGEKPYKHECGRAFNKSSNYTKEKLQT
Download sequence
Identical sequences F6Q174
XP_001097169.1.72884 9544.ENSMMUP00000013116 ENSMMUP00000013116 ENSMMUP00000004919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]