SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013370 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013370
Domain Number 1 Region: 214-311
Classification Level Classification E-value
Superfamily HMG-box 7.59e-22
Family HMG-box 0.0000305
Further Details:      
 
Domain Number 2 Region: 92-173
Classification Level Classification E-value
Superfamily HMG-box 1.31e-20
Family HMG-box 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013370   Gene: ENSMMUG00000010217   Transcript: ENSMMUT00000014274
Sequence length 390
Comment pep:novel chromosome:MMUL_1:14:88503791:88504960:1 gene:ENSMMUG00000010217 transcript:ENSMMUT00000014274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPRSQGHWSNKDILRLLECIENNLPSDGNSTFSSIQSHMDWGKVAFKNFSGEMCRLKW
LEISCSLRKFGTLKELVLEAKKCVKNTNKSRKVRNHPDFPKRPLTAYIRFFKENWPRYSQ
MYPGMRSQELTKILSKKYKELPEQMKQKYIQDFQKEKQEFEEKLARFREEHPDLVQKAKK
SDVSKRIQTKVQKKVQKNMEEVRSLPKTDQFLKKVKFHGEPQKPPMNGYHKFHQDSWSSK
ELQHLSLRERMVEIGRRWQRVPQSQKDHYKSQAEELQKQYKVKLDLWLKTLSPENYAAYK
ESTYAKGKNMAMTGGPDPRLRQTDPQSSSAKGLQEGFGEGQGLQAAGTDSSQTTWVNCHV
SLEPEENRKKDGEEEESSDSSDCSSGEEME
Download sequence
Identical sequences ENSMMUP00000013370 ENSMMUP00000013370 9544.ENSMMUP00000013370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]