SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013437 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013437
Domain Number 1 Region: 180-418
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.5e-51
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 17-129
Classification Level Classification E-value
Superfamily POZ domain 1.41e-29
Family Tetramerization domain of potassium channels 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013437   Gene: ENSMMUG00000010267   Transcript: ENSMMUT00000014347
Sequence length 477
Comment pep:known chromosome:MMUL_1:8:100971135:100976791:1 gene:ENSMMUG00000010267 transcript:ENSMMUT00000014347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCD
DYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCS
YSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNP
GYSVLSRVFSILSILVVMGSIITMCLNSLPDFQIPDSQGNPGEDPRFEIVEHFGIAWFTF
ELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESTPTLANLGRVAQVLRLM
RIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTIEKEENEGLAT
IPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQ
KQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMASLTNMSRSSPSELSLNDSLH
Download sequence
Identical sequences A0A096MPK3 A0A0D9SB95 A0A2K5HE27 A0A2K5KXJ8 A0A2K5XFX9 A0A2K6B157 A0A2K6K037 A0A2K6NR70 F6PWB2 G3QJZ2 G7PCA8 H2PQW6 H2RIE6
ENSPANP00000001663 XP_001094800.1.72884 XP_002819364.1.23681 XP_003311927.3.37143 XP_004047405.1.27298 XP_007999374.1.81039 XP_010383920.1.97406 XP_011730033.1.29376 XP_011808115.1.43180 XP_011855402.1.47321 XP_011917012.1.92194 XP_015310547.1.63531 XP_017747955.1.44346 ENSPPYP00000021063 ENSMMUP00000013437 ENSMMUP00000013437 ENSGGOP00000002752 ENSGGOP00000002752 9544.ENSMMUP00000013437 9600.ENSPPYP00000021063 ENSPPYP00000021063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]