SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013780 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013780
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.16e-40
Family D-ribulose-5-phosphate 3-epimerase 0.0000424
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013780   Gene: ENSMMUG00000010513   Transcript: ENSMMUT00000014710
Sequence length 182
Comment pep:known chromosome:MMUL_1:12:73783942:73801753:1 gene:ENSMMUG00000010513 transcript:ENSMMUT00000014710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKSCSVAQAEVQWHSQ
GPLPTLAAVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQ
FPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSL
DR
Download sequence
Identical sequences ENSMMUP00000013780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]