SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013941 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013941
Domain Number 1 Region: 845-923
Classification Level Classification E-value
Superfamily DEATH domain 4.04e-19
Family DEATH domain, DD 0.0000628
Further Details:      
 
Domain Number 2 Region: 156-247
Classification Level Classification E-value
Superfamily Immunoglobulin 6.16e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 246-296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000562
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 302-349
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 5 Region: 49-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000273
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013941   Gene: ENSMMUG00000010638   Transcript: ENSMMUT00000014881
Sequence length 948
Comment pep:known chromosome:MMUL_1:8:35913429:36160006:1 gene:ENSMMUG00000010638 transcript:ENSMMUT00000014881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILVLVKALSDVCAGTSGFLLDFSSRTSPGTDNGEALPESIPSAPGTLPHFIEEPDDAYI
IKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEESLDESSGLKVREVFINVTRQQVED
FHGPEDYWCQCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRPPEG
VPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRSLSA
TVVVYVNGGWSSWTEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTSLC
PVDGSWEVWSEWSVCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCILDKKP
LHEIKPQSIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGVDVIDSSALTGGFQ
TFNFKTVRQGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSDIKVKV
QSSFMVSLGVSERAEYHGKNHSRTFPHGNNHSFSTMHPRNKTPYIQNLSSLPTRTELRTT
GVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEVLLSPEVTC
GPPDMIVTTPFALTIPHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSCYCLLDPFA
CHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVVS
DERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVWCSNRQP
LHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFFAQEDSTFPAQ
TGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLW
EARHQHDGDLDSLACALEEIGRTHTKLSNISESQLDEADFNYSRQNGL
Download sequence
Identical sequences A0A2I3MMZ7 A0A2K5X4F2 F7BCW0
9544.ENSMMUP00000013941 ENSMMUP00000013941 ENSMMUP00000013941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]