SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013995 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013995
Domain Number 1 Region: 25-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.27e-19
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013995   Gene: ENSMMUG00000010679   Transcript: ENSMMUT00000014937
Sequence length 261
Comment pep:known_by_projection chromosome:MMUL_1:9:100588829:100598404:-1 gene:ENSMMUG00000010679 transcript:ENSMMUT00000014937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPG
VVIYVNSRPCCVPRVVAEYLNGSVREESIHCKSVEEISTLVQKLANQSGLDVIRIRKPFH
TDNPSIQGQWHPFTNKPTTFRELCPREVQDPAPAQDAAEFLSEGAGPCWYSIVALPQKHI
AIAIHPSQPAGQCHQAIGHWPETVCSCTADPPARLARPTRPPHSGSYLIFTDLCSSPYAV
PSSLPPHCPCTDHCVLSVKAA
Download sequence
Identical sequences A0A2K5YFY2 A0A2K6D140 F7AXE6
9544.ENSMMUP00000013995 ENSMMUP00000013995 ENSMMUP00000013992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]