SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014047 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014047
Domain Number 1 Region: 223-524
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.44e-80
Family Arginine methyltransferase 0.000000000246
Further Details:      
 
Domain Number 2 Region: 34-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-36
Family variant C2H2 finger 0.00000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014047   Gene: ENSMMUG00000010719   Transcript: ENSMMUT00000014992
Sequence length 530
Comment pep:known_by_projection chromosome:MMUL_1:14:51369785:51496257:-1 gene:ENSMMUG00000010719 transcript:ENSMMUT00000014992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSLASGATGGRGAVEDEEDPPELSDSGDEAAWEDEDDADLPHDKQQTPCLFCNRLFTSA
EETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEY
LKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKCMEARALSAEAELARAR
EDLQKMKQFAQDFVMNADVRTCSSSTSIIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRT
ESYRDFIYQNPHIFKDKVVLDVGCGTGILSLFAAKAGAKKVLGVDQSEILYQAMDIIRLN
KLEDTITLIKGKIEEVHLPVEKVDVIISEWMVKVLVLRAVLYCFLFLTTGYKMKHGFYPD
ICTISLVAVSDVNKHADRIGFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKH
IDCHTTSISDLEFSSDFTLKITKTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK
QTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ
Download sequence
Identical sequences ENSMMUP00000014047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]