SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014090 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014090
Domain Number 1 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-27
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-24
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 252-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.83e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 5-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.29e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 494-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-19
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 214-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-16
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 8 Region: 411-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000348
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 174-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000975
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014090   Gene: ENSMMUG00000010758   Transcript: ENSMMUT00000015038
Sequence length 555
Comment pep:known chromosome:MMUL_1:19:59216896:59239868:-1 gene:ENSMMUG00000010758 transcript:ENSMMUT00000015038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFTQLTFRDVAIEFSQEEWKCLNSTQRTLYRDVMLENYRNLVSLDLSRNCMIKELAPQR
ESNREEVFHTVTLEQHEKHDIEEFCFREMKKKIHDFDCQWRDNERNYNKATMAPKENLTC
RRDQHDRSGIENKSIKNQLGLSFLPHPPELQQFQAEGKIYECNHVEKSVNHGSSVSAPQI
ISSTVKTHISNKYGTDFVCSSLLTQEQKSCIREKPYRYNECDKALNHGSHMTVHQVSHSG
EKRYKCDLCGKVFSQKSNLARHRRVHTGEKPYKCNECDKGFSRNSCLALHRRVHTGEKPY
KCYECDKVFSRNSCLALHQKIHIGEKPYKCNVCGKAFSVRSTLSNHQVIHSGEKPYKCNE
CGKVFSQTSSLATHQRIHTGEKPYKCNECGKVFSQTSSLARHWRIHTGEKPYKCNECGKV
FSYNSHLASHQRVHTGEKPYKCNECGKAFSVHSNLTTHQVIHTGEKPYKCNECGKAFSVH
SSLTTHQVIHTGEKPYKCNECGRSFSVRPNLTRHQIIHTGKKPYKCSDCGKSFSVRPNLF
RHQIIHTKEKPYKRN
Download sequence
Identical sequences F7FXM7
9544.ENSMMUP00000014090 ENSMMUP00000014090 ENSMMUP00000013628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]