SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014186 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014186
Domain Number 1 Region: 235-284,322-446
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000011
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 489-545
Classification Level Classification E-value
Superfamily EF-hand 0.0000622
Family Calmodulin-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014186   Gene: ENSMMUG00000010818   Transcript: ENSMMUT00000015136
Sequence length 668
Comment pep:known_by_projection chromosome:MMUL_1:9:99890332:99933826:-1 gene:ENSMMUG00000010818 transcript:ENSMMUT00000015136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSSAYYYTKVMSELFLHTASDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQSL
GHGSHSFIYYENLLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPL
NGTAWTYHSQDELGGSSHWGRLTSYSGGGYYLDLPGSRQGSAEALRDLQEGLWLDRGTRV
VFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDFFIVGCEVVFC
VFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQ
QPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGF
AVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAY
FVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKE
RVSDVQKVLQGGEQEIQFEDFTNTLREMGHAEHEITELTATFTKFDRDGNRILDEKEQEQ
MRQDLEGERVALDTEIEKLGRSVVSTPQGESGPEAAKAGGWVSGEEFYMLTRRVLQLETV
LEGVVSQVDAVGSKLKMLETKGWLVPSPGVEEQAIWKHLQPAPAVTPDPWGVQGGQESEV
PYKRERKP
Download sequence
Identical sequences ENSMMUP00000014186 9544.ENSMMUP00000014186 ENSMMUP00000014186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]