SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014201 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014201
Domain Number 1 Region: 766-823
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 710-767
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 654-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-17
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 812-864
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000126
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 7 Region: 481-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000129
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 560-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000613
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 9 Region: 204-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000859
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 10 Region: 314-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000083
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 2-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000209
Family KRAB domain (Kruppel-associated box) 0.0048
Further Details:      
 
Domain Number 12 Region: 619-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000161
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 13 Region: 233-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000194
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014201   Gene: ENSMMUG00000010838   Transcript: ENSMMUT00000015155
Sequence length 871
Comment pep:known chromosome:MMUL_1:19:56303333:56322463:1 gene:ENSMMUG00000010838 transcript:ENSMMUT00000015155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEEFVTLKDVGMDFTLEDWEQLGLEQGDVFWDTALDNCQDLLLLDPPRPNLTSHPDGGE
DLEPLPGGSPEATGPDATETKNSPLMEDFLEEGFSQEIIEMLSKDGFWNSNFGEACVEDT
WLDGLLGDPESLLRSDVATNGEGPTECKSYELKRGLSPVSTLSTGEDSMIHNVSEKTLTP
AESKEYRGAFDSYSDHSQQDSVQEGEKPYKCSECGKSFSGSYHLTQHWITHTGEKPTVHQ
ECEQGFDQNASFSVYPKTHTGYKFYVCNEYGTTFSQSTNLWHQKTHTGEKPCKSQYSDHP
PSHDTQPGEHQKTHTDSKSYNCNECGKAFTRIFHLIRHQKTHTRKRYECSKCQATFSLRK
HLIQHQKTHTAKTTSECRECGKTFRQSSLLIEHQALHTGEKPYKCNECGKSFSHNSTLKI
HQRVHSGEKPYKCSECGKAFRRHTHLNEHRRIHTGYRPHKCQACIKSFSRPSHLMRHQAI
HTAEKPYRCAECKETFSDNSHLVQHQKMHTVKTPYECQECGERFICSSTLKCHQSVHTRE
KQGFVVSGKILDQNPQQKEKCFKCNQCEKTFSCGKYLTQHERIHTSGVKPFECDQCGRAF
GQSTQLIHHQRIHSRVRLYKWGEQGKAISSASLLKLQSSHTKEHPFKCNECGKTFSQSAH
LSKHQLIHAGGNPFKCSKCDRVFTQRNYLVQHERTHARKKPLVCNECGKTFRQSSCLSKH
QRIHSGEKPYVCDYCGKAFGLSAELVRHQRIHTGEKPYVCQECGKAFTQSSCLSIHRRVH
TGEKPYICGECGKAFAQKANLTQHQRIHTGEKPYSCNVCGKAFGLSAHLNQHLRVHTQET
LYQCQRCQKAFRCHSSLTRHQRVHNKQQYYL
Download sequence
Identical sequences F6ZNC7
9544.ENSMMUP00000014201 NP_001247500.1.72884 XP_014979897.1.72884 ENSMMUP00000014201 ENSMMUP00000031510 ENSMMUP00000014201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]