SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014356 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014356
Domain Number 1 Region: 436-494
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.05e-17
Family Erythroid transcription factor GATA-1 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014356   Gene: ENSMMUG00000010944   Transcript: ENSMMUT00000015318
Sequence length 593
Comment pep:known_by_projection chromosome:MMUL_1:18:15178731:15208995:1 gene:ENSMMUG00000010944 transcript:ENSMMUT00000015318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTDGGWCLPKRFGAAGADASDSGAFPARDPSTPPSPISSSSSSCSRGGERGPGGASNC
GTPQLDAEAAAGPPARSLLLSSYASHPFGVPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQ
AATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAA
AAASSPVYVPTTRVGSMLPGLPYHLQGSGSGPANHAGGAGAHPGWPQASADSPPYGGGGG
AAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPGGYAAAGSGGAGGVSGGGSSL
AAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWPAGPFETPVLH
SLQSRAGAPLPVPRGPSAGLSRPESGSAEAILFTSSQTLLWVISNLTHTLNSCVWEPLGG
ENAIVKNTWKCLPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLA
MKKEGIQTRKRKPKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAG
APVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRQDSWCALALA
Download sequence
Identical sequences ENSMMUP00000014356 9544.ENSMMUP00000014356 ENSMMUP00000014356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]