SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014406 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014406
Domain Number 1 Region: 585-864
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-69
Family Protein kinases, catalytic subunit 0.00000814
Further Details:      
 
Domain Number 2 Region: 279-558
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-42
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 3 Region: 144-247,284-308
Classification Level Classification E-value
Superfamily SH2 domain 2.57e-17
Family SH2 domain 0.0036
Further Details:      
 
Domain Number 4 Region: 39-132
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000344
Family Third domain of FERM 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014406   Gene: ENSMMUG00000010996   Transcript: ENSMMUT00000015376
Sequence length 897
Comment pep:known_by_projection chromosome:MMUL_1:19:17393746:17410199:-1 gene:ENSMMUG00000010996 transcript:ENSMMUT00000015376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHSLMAKYIMDLERLDPAGAAETFHVSLPGVPGGQDGLGLLRVAGDGGIAWTQGEQEVLQ
PFCDFPEIVDISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFR
LTTDSQHFFCKEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDS
FLLTVCVQTPLGPDYKGCLIRRSPTGSFFLVGLSRSHSSLRELLAACWDGGLHVDGVTVT
LTSCCIPRPKEKSNLIVVQRGRSPPTSSLVQPQSQCQLSQMIFHKIPADSLEWHENLGHG
SFTKIYRGCRHEVVDGESRKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGV
CMAGDSTMVQEFVHLGAIDTYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSA
RKVLLAREGTDGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLRKAQTLSLEADKWG
FGATVWEVFSGVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSF
RAVIRDLNSLISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGK
GNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVS
YGPGEPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVH
RDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQ
SDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACP
AEVHELMKLCWAPSPQDRPSFSTLGPQLDMLWSGSRGCETHAFTAHPEGKPHSLSFL
Download sequence
Identical sequences 9544.ENSMMUP00000014406 ENSMMUP00000014406 ENSMMUP00000014406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]