SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014435 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014435
Domain Number 1 Region: 166-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 390-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.48e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 222-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-23
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 5 Region: 617-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 656-708
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 2-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-21
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 8 Region: 279-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 9 Region: 110-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 10 Region: 462-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.76e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 11 Region: 558-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-17
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 12 Region: 54-111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-16
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 13 Region: 517-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000124
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014435   Gene: ENSMMUG00000032296   Transcript: ENSMMUT00000015411
Sequence length 714
Comment pep:known_by_projection chromosome:MMUL_1:1:3549277:3551670:1 gene:ENSMMUG00000032296 transcript:ENSMMUT00000015411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSIALNQHKKIHTGEKPYKCEECGKAFGRSTALNQHKKIHTGEKPYKCEESGKAFSTSRN
LAAHKRIYTGEKPYTCEDPGRAFGWSTNLNEYKKIHTGDKPYKYKECGEVFKQSSHLNTH
EKIHTRKKPVKCKECGKVITSSSSFAQHKRIHTGEKPFKCLECGKAFNSSTILTKHRRIH
TGEKPYTCEECGKAFRQSAILYVHRRIHTGEKPYTCEECGKTFRQSANLSAHRRIHTGEK
PYKCEECGKAFGQYTDLNRHKNIHTREKPYKCEECGQHFAWRTALNQHKKIHTGEKPYKC
EESGKAFSSSRNLAAHKRIYTGQKPYTCEKCGKAFNSSTVLTKHRRIHTGEKPYTCEECG
KAFRQSAILYVHRRIHTGEKPYTCEECGKTFRQSANLYAHRRIHTGEKPYKCEECGKAFG
RYTDLNRHKNIHTREKPYKCEECGKHLAWHTDLNQHNKTYTGEKPSKCEECGKAYALSTD
LNQHKKILTGEKHYKCEECGKAFGRSTALNQHKKIHTGEKPYKYEEGDKAFSRSRNLAAH
KRIYTREKPYTCEDRGRAFRWSTNVNEYKKIHTGDKPYKCKERGEVFKQSSHLNRQEKIH
TGKKPYKCEECGKVITSSSSFAKHKRIHTGEKPFKCLECGKAFNSSTVLTKHRRIHTGEK
PYTCEECGKAFRQSAILYVHRRIHTGEKPYTCEECGKTFRQSANLYAHKKIHTG
Download sequence
Identical sequences ENSMMUP00000014435 9544.ENSMMUP00000014435 ENSMMUP00000040707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]