SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014496 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014496
Domain Number 1 Region: 337-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 421-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 281-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 1-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.71e-17
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 6 Region: 225-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000286
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 383-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000782
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000424
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 9 Region: 198-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000241
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014496   Gene: ENSMMUG00000005404   Transcript: ENSMMUT00000015478
Sequence length 581
Comment pep:novel chromosome:MMUL_1:9:36996730:37002323:-1 gene:ENSMMUG00000005404 transcript:ENSMMUT00000015478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLKDVIVEFTKEEWKLLTFAQRTLYKDVMLENYSHLVSVEVEVNKSILGTRKNICVPVS
PLKESKFAKPNCNLHHSPETPLPHLSQSLNSKQFVSFPSYFHSQVTIYDLMSCVSELTLH
KSLSKRCLITEPLKILYFPKQWARDSLVEDLWSIHDLESRYRESQAGNSRQVQELMCQRM
FTVEKPYGTNKYGSISRNQSSEKVKHQKTRTTEKAYECKECGKFFCQKSALIVHQHTHSK
GKSYDCDKCGNSFSKNEDLTRHQKIYTRDKTYECKECEKIFYHLSSLSRHLRTHAGEKPY
ECNQCEKSSYQKPHLIEHQKTHTGEKPFECTECGKFFYVKAYLMVHQKTHTGEKPYECKE
CGKAFSQKSHLTVHQRTHTGEKPYKCKECGKFFSRNSHLRTHQRTHTGEKPYECKECRKC
FYQKSDLTVHQRTHTGEKPFECNKCGKTFYYKSDLTKHQRKHTGEKPYECTECGKSFSVN
SVLRLHQRTHTGEKPYSCKECEKSFSQKSHFIIHQRKHTGEKPYECQECGETFIQKSQLT
AHQKTHTKKRKAEKSHANCKTGGKPFRRHTFVLQHRNHTGE
Download sequence
Identical sequences ENSMMUP00000014496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]