SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014512 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014512
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.27e-26
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 2 Region: 422-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 310-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.96e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 254-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.32e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 216-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 464-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-18
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014512   Gene: ENSMMUG00000011083   Transcript: ENSMMUT00000015494
Sequence length 536
Comment pep:known chromosome:MMUL_1:19:43811761:43843347:1 gene:ENSMMUG00000011083 transcript:ENSMMUT00000015494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGLLKAMYQELVTFRDVAVDFSQEEWDCLDSSQRHLYSNVMLENYRILVSLGLCFSKP
SVILLLEQGKAPWMVKRELTKGLCSGWEPICETEELTPKQDFYEEHQSQKIIETLTSYNL
EYSSLKEEWKCEGYFERQPGNQKACFKEEIITHEEPLVDEREQEYKSWGSFHQNPLLCTQ
RIIPKEEKVHKHDTQKRSFKKNLMAIKPKSVCAEKKLLKCNDCEKVFSQSSSLTLHQRIH
TGEKPYKCIECGKAFSQRSNLVQHQRIHTGEKPYECKECRKAFSQNAHLVQHLRVHTGEK
PYECKVCRKAFSQFAYLAQHQRVHTGEKPYECIECGKAFSNRSSIAQHQRVHTGEKPYEC
NVCGKAFSLRAYLTVHQRIHTGERPYECKECGKAFSQNSHLAQHQRIHTGEKPYKCQECR
KAFSQIAYLAQHQRVHTGEKPYECIECGKAFSNDSSLTQHQRVHTGEKPYECTVCGKAFS
YCGSLAQHQRIHTGERPYECKECKKTFRQHAHLAHHQRIHIGESLSPPNPVNHQVL
Download sequence
Identical sequences A0A2K6DA80 F7FX24 G7PXE8
9544.ENSMMUP00000014512 XP_001105834.1.72884 XP_011763249.1.29376 XP_011763250.1.29376 XP_011763251.1.29376 XP_011763252.1.29376 XP_011935216.1.92194 XP_014979109.1.72884 XP_014979110.1.72884 XP_014979111.1.72884 XP_015296704.1.63531 XP_015296705.1.63531 XP_015296706.1.63531 XP_015296707.1.63531 ENSMMUP00000014512 ENSMMUP00000014512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]