SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014517 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014517
Domain Number 1 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.27e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.99e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 3-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.85e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 8 Region: 552-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.88e-21
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 9 Region: 455-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 10 Region: 128-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000101
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014517   Gene: ENSMMUG00000011091   Transcript: ENSMMUT00000015501
Sequence length 609
Comment pep:known chromosome:MMUL_1:19:43904229:43936291:-1 gene:ENSMMUG00000011091 transcript:ENSMMUT00000015501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHLLVTFRDVAIDFSQEEWECLDPAQRDLYRDVMLENYSNLISLDLESSRATKELSPEK
EIYEMESLQWENMGKLINHHLQYNGLGDNMECKGNLEGQEASQEGLYMCVKITCEERATE
SHSTSSTFHRIIPTKEKLYKCKECRQGFSYLSCLIQHEKNHNIEKCSEVKKHRNTFSKKP
NYMQHQRIQTGEKPYECMECGKAFSRSSDLIQHQKIHTNEKPYQCNACGKAFIRGSQLTE
HQRVHTGEKPYECKKCGKAFSYCSQYTLHQRIHSGEKPYECKDCGKAFILGSQLTYHQRI
HSGEKPYECKECGKAFILGSHLTYHQRVHTGEKPYICKECGKAFLCASQLNEHQRIHTGE
KPYECKECGKAFFRGSQLTYHLRVHSGERPYKCKECGKAFISNSNLTQHQRIHTGEKPYK
CKECGKAFICGKQLSEHQRIHTGEKPFECKECGKAFIRVAYLTQHEKIHGEKHYECKECG
KTFVRATQLTYHQRIHTGEKPYKCKECDKAFIYGSQLSEHQRIHRGEKPYECKQCGKAFI
RGSHLTEHLRTHTGEKPYECKECGKGFSRGSELTLHQRIHTGEKPYTCGQCGKEFRRPSQ
LTQHIRLHN
Download sequence
Identical sequences A0A2K5V532 A0A2K6B732 F7FX09
XP_005589094.1.63531 XP_005589095.1.63531 XP_011763270.1.29376 XP_011763271.1.29376 XP_011763272.1.29376 XP_014979098.1.72884 XP_014979099.1.72884 XP_015296703.1.63531 ENSMMUP00000014517 ENSMMUP00000014517 9544.ENSMMUP00000014517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]