SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014521 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014521
Domain Number 1 Region: 3-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-25
Family KRAB domain (Kruppel-associated box) 0.00085
Further Details:      
 
Domain Number 2 Region: 559-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 308-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 252-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.39e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 601-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 199-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.45e-19
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 9 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-19
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 10 Region: 466-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000128
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014521   Gene: ENSMMUG00000011092   Transcript: ENSMMUT00000015505
Sequence length 660
Comment pep:known_by_projection chromosome:MMUL_1:19:43936422:43955420:1 gene:ENSMMUG00000011092 transcript:ENSMMUT00000015505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHALVTFRDVAIDFSQKEWECLDTTQRKLYRDVMLENYSNLVSLGYSGSKPDVITLLEQ
GKEPCVAVRDVTGRQYPGLLSRHKTKKLPSEKDIHEISLSKGSIIEKSKTLRLKGSILRN
EWQNKSEFEGQQGLEERSISQKKIVSKKMSAGRKHPSFTLNQRIHNSEKSCDSNLVQHGK
TDSDVKRDCKERGSTLNKVCQLTLHQKIHTGEKSCKCEKCGKVFSHSYQLTLHQRFHTGE
KPYECQECGKNFLLYSQLNRHQKIHTGKKPYMCKKCDKGFFSRLELTQHKRIHTGEKSYE
CKECGKVFQLVFYLKEHERIHTGKKPYECKECGKAFSVGGQLTRHQKIHTGVKPYECKEC
GKTFGLSFYLTEHRRTHAGKKPYECKECGKSFNMRGPLNRHKTIHTGIKPFECKVCEKAF
SYSGDLRVHSRIHTGEKPYECKECGKAFMLRSVLTEHQRLHTGVKPYECKECGKTFRVRS
QISLHKKIHTDVKPYKCVRCGKTFRFGFYLTEHQRIHTGEKPYKCKECGKAFIRRGNLKE
HLKIHSGLKPYDCKECGKSFSRRGQFTEHQKIHTGVKPYKCKECGKAFSRSVDLRIHQRI
HTGEKPYECKQCGKAFRLNSHLTEHQRIHTGEKPYECKVCRKAFRQYSHLYQHQKTHNVI
Download sequence
Identical sequences ENSMMUP00000014519 ENSMMUP00000014521 9544.ENSMMUP00000014521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]